PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G021400.1
Common NamePHAVU_002G021400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 398aa    MW: 44488.2 Da    PI: 8.3361
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G021400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.6e-32252307156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v++Lt+++vkSHLQkYRl+
  Phvul.002G021400.1 252 KQRRCWSPELHRRFVDALQQLGGAQVATPKQIRELMQVESLTNDEVKSHLQKYRLH 307
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.207249309IPR017930Myb domain
SuperFamilySSF466894.78E-18250310IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-29250310IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26252307IPR006447Myb domain, plants
PfamPF002493.0E-7254305IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MNLYPLLVYT FFLRYHLKSG YGMVVCDLWE HTLAHRKSPN PPPQHHRAFM ELSLDLSLGF  60
VPKPISLFFA EVSANRDKRD KVATLDGFVQ RLEDELRKVE AFKRELPLCM LLLNDAIARL  120
KEEKGKCSIS QDPPTSEEFM PPKTISGGKE NERCEKKNWM SSAQLWSTQK IKSRNEESDR  180
SVPENPIDGN SCAPRKEGSQ IPSFSLMGHA SELSHSNSKS VCGDTSSGSS LLRVEVQSQP  240
QPPQHMQQNP RKQRRCWSPE LHRRFVDALQ QLGGAQVATP KQIRELMQVE SLTNDEVKSH  300
LQKYRLHVRR FPVSSVGQAD NGSWMVQDQC GDKSKGNFSQ SGSPQGPLTP FLLGGGGSAK  360
GISSPGRNSV DAEDEQSDCR NWKGGLHQHL EADNQSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-135AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156835.10.0hypothetical protein PHAVU_002G021400g
TrEMBLV7CFC00.0V7CFC0_PHAVU; Uncharacterized protein
STRINGGLYMA01G39040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-57G2-like family protein